Human CD40 (TNRRSF5: tumor necrosis factor receptor superfamily member 5, isoform 2) is a 203 amino acid cell surface protein. This protein belongs to a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

Full-length extracellular domain of human CD40 gene (Isoform-II, 21-193 aa) was constructed with 31 N-terminal T7/His tag and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.

 

Parameter, Testing, and Method	CD40, Human, Recombinant Catalog # 5093
Quantity	0.1 mg (100 µg/vial)
Volume	0.2 mL
Concentration	0.5 mg/mL
Purity	>90% as measured by SDS PAGE
Formulation	Formulated in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol.
Form	Solution
Production Type	Recombinant – E. coli
Storage Temperature	Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days
Shelf Life	12 months after receipt
Sterilization Method	Filtration
Cell Attachment Activity	Passes
Sterility	No growth
Accession Number	NP_690593
Recombinant Protein Sequence	MASMTGGQQMGRGHHHHHHGNLYFQGGEFELEPPTACREK QYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDT WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGW HCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVG FFSNVSSAFEKCHPWTRSPGSAESPGGDPHHLRDPVCHPL GAGL